HORDB

ID: hor000964
Uniprot ID: P23362
Protein name: Cholecystokinin
Gene name: CCK
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
GO CC: GO:0005576 extracellular region; GO:0030424 axon

Sequence: QPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Length: 95
Propeptide: MNSGVSLCVLMAVLAAGALTQPVPPAEPAGSGLQRAEEAPRRQLRAVQRTDGESRAHLGALLARYIQQARKAPSGRMSIIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Signal peptide: MNSGVSLCVLMAVLAAGALT
Modification: T77 Sulfotyrosine;T83 Phenylalanine amide;T91 Sulfotyrosine;T93 Sulfotyrosine
Glycosylation: NA
Mutagenesis: NA

Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Mechanism: NA
Cross BBB: NA
Target: CCKAR
Target Unid: G7P5D4
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000964_AF2.pdb

hor000964_ESM.pdb

Mass:	1243887	Formula:	C462H738N150O142S3
Absent amino acids:	C	Common amino acids:	R
pI:	9.98	Basic residues:	17
Polar residues:	22	Hydrophobic residues:	26
Hydrophobicity:	-98.63	Boman Index:	-28699
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	62.84
Instability Index:	8166.84	Extinction Coefficient cystines:	11460
Absorbance 280nm:	121.91